missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Nectin 3 (aa 94-220) Control Fragment Recombinant Protein

Product Code. 30210000
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210000

Brand: Invitrogen™ RP90495

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82410 (PA5-82410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nectin-3 is a 83 kDa type I transmembrane glycoprotein. Nectin, originally isolated as poliovirus receptor-related protein (PRR), is a cell-cell adhesion molecule of the immunoglobulin supergene family. Nectins are calciumindependent immunoglobulin-like cell-cell adhesion molecules consisting of four members, nectin 1-4. Nectins homophilically and heterophilically trans-interact to form a variety of cell-cell junctions, including cadherin-based adherens junctions in epithelial cells and fibroblasts in culture, synaptic junctions in neurons, and Sertoli cell-spermatid junctions in testis, in cooperation with, or independently of, cadherins. Both nectin-2 and nectin-3 are ubiquitously expressed, whereas nectin-1 is abundantly expressed in brain. Nectin-2 and -3 are expressed in cells where cadherin is not expressed, such as blood cells and spermatids. All members of the nectin family have two or three splice variants. For nectin-3, three isoforms exist: nectin-3 alpha, -3 beta and -3 gamma, of which nectin-3 alpha is the largest. Nectin-3, also known as PRR3, is a transmembrane protein that is predominantly expressed in testis and placental tissues as well in many cell lines. Nectin interacts in vivo with both long and short isoforms of afadin, an actin binding protein, at cadherin-based cell-cell adherence junctions in various tissues and cell lines. Furthermore, the ectodomains of nectin-3 and CD155 (Poliovirus Receptor) have shown strong affinity to each other. Injection of antibody 103-A1 into lumen of seminiferous tubules leads to disruption of the actin filaments in Sertoli cells at the Sertoli-maturing spermatid ectoplasmic specialization and exfoliation of maturing spermatids form the seminiferous epithelium.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQS3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25945
Name Human Nectin 3 (aa 94-220) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610301B19Rik; 3000002N23Rik; 4921513D19Rik; AA407785; AU016832; AW538082; CD113; CDW113; DKFZP566B0846; FLJ90624; nectin 3; nectin cell adhesion molecule 3; Nectin3; Nectin-3; poliovirus receptor-related 3; poliovirus receptor-related protein 3; PPR3; PRR3; PVRL3; PVRR3
Common Name Nectin 3
Gene Symbol NECTIN3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.