missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204626

Invitrogen™ Human NDUFV1 (aa 192-284) Control Fragment Recombinant Protein

Product Code. 30204626
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204626 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204626 Supplier Invitrogen™ Supplier No. RP108033

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67373 (PA5-67373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49821
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4723
Name Human NDUFV1 (aa 192-284) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CI-51 K; CI51KD; CI-51 kD; complex I 51 kda subunit; complex I 51 kDa subunit; complex I, mitochondrial respiratory chain; complex I-51 kD; mitochondrial NADH dehydrogenase (ubiquinone) 51 kDa subunit; mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1; mitochondrial NADH:ubiquinone oxidoreductase 51 kda subunit; NADH dehydrogenase; NADH dehydrogenase (ubiquinone) flavoprotein 1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51 kDa; NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NADH dehydrogenase flavoprotein 1; NADH dehydrogenase flavoprotein 1; 24 kDa (FP); NADH dehydrogenase ubiquinone flavoprotein 1; NADH:ubiquinone oxidoreductase core subunit V1; NADH-ubiquinone oxidoreductase 51 kDa subunit; NDUFV1; UQOR1; wu:fc01f01; wu:fc12f12; zgc:86620
Common Name NDUFV1
Gene Symbol NDUFV1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.