missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212250

Invitrogen™ Human MYO16 (aa 945-1025) Control Fragment Recombinant Protein

Product Code. 30212250
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212250

Brand: Invitrogen™ RP107852

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67217 (PA5-67217. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. May be involved in targeting of the catalytic subunit of protein phosphatase 1 during brain development. Activates PI3K and concomitantly recruits the WAVE1 complex to the close vicinity of PI3K and regulates neuronal morphogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6X6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23026
Name Human MYO16 (aa 945-1025) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BM140241; C230040D10Rik; Gm1105; Kiaa0865; LOW QUALITY PROTEIN: unconventional myosin-XVI; mKIAA0865; MYAP3; MYO16; myo16 {ECO:0000250; MYO16 variant protein; Myo16b; Myosin heavy chain myr 8; myosin XVI; myosin-XVI; myosin-XVI; unconventional myosin-XVI; Myr8; neuronal tyrosine phosphorylated adaptor for phosphoinositide 3-kinase adaptor 3; neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3; neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 3; NYAP3; PPP1R107; protein phosphatase 1, regulatory subunit 107; unconventional myosin-16; Unconventional myosin-XVI; UniProtKB:Q9Y6X6}
Common Name MYO16
Gene Symbol Myo16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LFQSKLSQTGSLVSAYPSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.