missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197476

Invitrogen™ Human MR1 (aa 149-226) Control Fragment Recombinant Protein

Product Code. 30197476
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197476 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197476 Supplier Invitrogen™ Supplier No. RP106185

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65509 (PA5-65509. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T- cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q95460
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3140
Name Human MR1 (aa 149-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Class I histocompatibility antigen-like protein; H2ls; histocompatibility-2 complex class 1-like sequence; Hlals; Major histocompatibility complex class I-related gene protein; major histocompatibility complex, class I-like sequence; major histocompatibility complex, class I-related; MCH class I; MHC class I-like antigen MR-1; MHC class I-like sequence; MHC class I-related gene protein; MHC class-I related-gene protein; MR1; Mr1a
Common Name MR1
Gene Symbol MR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.