missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211369

Invitrogen™ Human MARK4 (aa 390-467) Control Fragment Recombinant Protein

Product Code. 30211369
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211369

Brand: Invitrogen™ RP97234

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83450 (PA5-83450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARK4 is a serine/threonine kinase that is likely to be directly involved in microtubule organization in neuronal cells. The encoded protein is associated with the centrosome throughout mitosis and may be involved in cell cycle control. Expression of MARK4 is a potential marker for cancer, and the encoded protein may also play a role in Alzheimer's disease. Pseudogenes of MARK4 are located on both the short and long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for MARK4.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96L34
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57787
Name Human MARK4 (aa 390-467) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410090P21Rik; C79806; FLJ90097; KIAA1860; MAP/microtubule affinity regulating kinase 4; MAP/microtubule affinity-regulating kinase 4; MAP/microtubule affinity-regulating kinase 4 L; MAP/microtubule affinity-regulating kinase like 1; MAP/microtubule affinity-regulating kinase-like 1; Mark4; MARK4 serine/threonine protein kinase; MARK4L; MARK4S; MARKL1; MARKL1L; microtubule affinity regulating kinase 4; Nbla00650; PAR-1 D
Common Name MARK4
Gene Symbol Mark4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.