missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MADD (aa 1409-1506) Control Fragment Recombinant Protein

Product Code. 30205622
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205622

Brand: Invitrogen™ RP97304

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83430 (PA5-83430. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor necrosis factor receptor 1 (TNFR1) contains a death receptor domain that mediates interactions involved in downstream signaling of TNF. A novel protein, MADD (mitogen activated protein (MAP)-kinase activating death domain protein) has recently been shown to associate with the death domain of TNFR1 through its own C-terminal death domain. This interaction is critical for TNFR1 signal generation. Overexpression of MADD activates the MAP (Mitogen Activated Protein) kinases extracellular signal-related kinase (ERK) and c-Jun N-terminal kinase (JNK) and induces the phosphorylation of cytosolic phospholipase A2. This discovery suggests that MADD links tumor necrosis factor TNF and MAP kinase activation and arachidonic acid release. MADD has a 98% homology with another protein, differentially expressed in neoplasmic vs. normal cells (DENN). DENN is a substrate for JNK3, and is important in the hypoxia and stress induced intracellular signalling pathways. MADD also has a 93% sequence conservation with a GDP/GTP exchange protein, Rab3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WXG6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8567
Name Human MADD (aa 1409-1506) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630059K23Rik; DENN; differentially expressed in normal and neoplastic cells; IG20; Insulinoma glucagonoma clone 20; insulinoma-glucagonoma protein 20; Kiaa0358; Madd; MAP kinase activating death domain; MAP kinase-activating death domain protein; MAP-kinase activating death domain; rab3 GDP/GTP exchange factor; Rab3 GDP/GTP exchange protein; Rab3 GEP; RAB3GEP
Common Name MADD
Gene Symbol MADD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.