missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208014

Invitrogen™ Human LRRC59 (aa 266-307) Control Fragment Recombinant Protein

Product Code. 30208014
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208014 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208014 Supplier Invitrogen™ Supplier No. RP95601

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83160 (PA5-83160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear pores. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96AG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55379
Name Human LRRC59 (aa 266-307) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA959742; C78668; hypothetical protein PRO1855; leucine rich repeat containing 59; leucine-rich repeat-containing protein 59; Leucine-rich repeat-containing protein 59, N-terminally processed; leucine-rich repeat-containing protein 59; LOW QUALITY PROTEIN: leucine-rich repeat-containing protein 59; LRRC59; p34; PRO1855; Protein p34; Rbp34; Ribosome-binding protein p34
Common Name LRRC59
Gene Symbol Lrrc59
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.