missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LGR5 (aa 411-557) Control Fragment Recombinant Protein

Product Code. 30210998
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210998

Brand: Invitrogen™ RP89666

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptor GPR49 has been reported to be expressed in brain, skeletal muscle, placenta, and spinal cord. ESTs have been isolated from normal human brain (amygdala), embryo, and placenta libraries and from human germ cell, uterus, and brain libraries. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This 'turn-off' activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75473
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8549
Name Human LGR5 (aa 411-557) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Fex; follicle expressed hormone; G protein-coupled receptor 49; GPR49; GPR67; G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38; GRP49; HG38; leucine rich repeat containing G protein coupled receptor 5; leucine rich repeat containing G protein-coupled receptor 5; leucine-rich repeat containing G protein-coupled receptor 5; leucine-rich repeat-containing G protein-coupled receptor 5; leucine-rich repeat-containing G-protein coupled receptor 5; Lgr5; orphan G protein-coupled receptor HG38; orphan G-protein coupled receptor FEX
Common Name LGR5
Gene Symbol Lgr5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.