missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210046

Invitrogen™ Human KLRB1 (aa 73-140) Control Fragment Recombinant Protein

Product Code. 30210046
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210046

Brand: Invitrogen™ RP95606

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83449 (PA5-83449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLRB1 (Killer cell lectin like receptor subfamily B, member 1, CD-161) protein is classified as a type II membrane protein because it has an external C terminus. KLRB1 cell surface antigen is expressed by almost all NK cells and in a small subset of CD3+ve T cells. KLRB1 is a homodimeric cell surface protein, comprising two chains with molecular weights ranging from 40-44kDa. KLRB1 plays an inhibitory role on natural killer (NK) cells. Activation of KLRB1 leads to acid sphingomyelnase/SMPD1 stimulation and an increase in intracellular ceramide. Moreover, there is also an activation of AKT1/PKB and RPS6KA1/RSK1 kinase stimulation, and T cell proliferation by anti-CD3. KLRB1 acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope and to the N-acetyllactosamine epitope. KLRB1 also binds to CLEC2D/LLT1 as a ligand, and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12918
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3820
Name Human KLRB1 (aa 73-140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930431A04Rik; Antigen 3.2.3; CD161; CD161 antigen-like family member A; CD161 antigen-like family member B; CD161a; CD161b; CLEC5B; C-type lectin domain family 5 member B; EMBL:AAQ11375.1}; Gm4696; HNKR-P1a; Immunoreceptor NKR-P1E; immunoreceptor NKR-P1G; inhibitory receptor NKR-P1B; killer cell lectin like receptor B1; killer cell lectin-like receptor subfamily A member 1 complex; killer cell lectin-like receptor subfamily B member 1; killer cell lectin-like receptor subfamily B member 1 complex; killer cell lectin-like receptor subfamily B member 1 A; killer cell lectin-like receptor subfamily B member 1 B; killer cell lectin-like receptor subfamily B member 1 B allele A; Killer cell lectin-like receptor subfamily B member 1 B allele B; killer cell lectin-like receptor subfamily B member 1 B allele C; killer cell lectin-like receptor subfamily B member 1 D; killer cell lectin-like receptor subfamily B member 1 F; killer cell lectin-like receptor subfamily B member 1 G; killer cell lectin-like receptor subfamily B, member 1; killer cell lectin-like receptor subfamily B, member 1 A; Klrb1; Klrb1a; Klrb1b; klrb1b {ECO:0000312; Klrb1d; Klrb1f; Klrb1g; Klrb6; lectin-like transmembrane protein Nkrp1g; Ly55; Ly-55; Ly55a; ly-55 A; Ly55b; ly-55 b; Ly55d; ly-55 d; lymphocyte antigen 55; lymphocyte antigen 55 complex, locus A; lymphocyte antigen 55 complex, locus B; lymphocyte antigen 55 complex, locus D; lymphocyte antigen 55 A; lymphocyte antigen 55 b; lymphocyte antigen 55 d; MGC138614; natural killer cell receptor; natural killer cell receptor protein NKR-P1A; natural killer cell receptor protein NKR-P1B; natural killer cell receptor-P1; natural killer cell surface protein NKR-P1B allele B6; Natural killer cell surface protein NKR-P1B allele RNK/SD/BN/F344; natural killer cell surface protein NKR-P1B allele SJL/BALB; natural killer cell surface protein NKR-P1B allele TO; natural killer cell surface protein NKR-P1G; Natural killer cell surface protein P1-2; natural killer cell surface protein P1-3.2.3; Natural killer cell surface protein P1A; natural killer lectin-like receptor 1 E; natural killer lectin-like receptor protein 1 e; NKR; NKR-P1; NKR-P1 2; NKR-P1 3.2.3; NKR-P1 34; NKR-P1.7; NKRP12; NKRP1A; NKR-P1A; Nkrp1-a; Nkrp1b; Nkr-p1b; Nkrp1-b; Nkrp1d; NKR-P1D; Nkrp1e; Nkr-p1e; Nkrp-1 e; Nkrp1g; NKR-P1G; RGD:2975}
Common Name KLRB1 (CD161)
Gene Symbol Klrb1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.