missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212982

Invitrogen™ Human KIRREL2 (aa 228-285) Control Fragment Recombinant Protein

Product Code. 30212982
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30212982 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30212982 Supplier Invitrogen™ Supplier No. RP108630

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84950 (PA5-84950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules. The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion. Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes. This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases. This gene and the related opposite-strand gene nephrin are regulated by a bidirectional promoter.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UWL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84063
Name Human KIRREL2 (aa 228-285) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C330019F22Rik; DKFZp564A1164; FILTRIN; kin of IRRE like 2; kin of IRRE like 2 (Drosophila); kin of irregular chiasm-like 2; kin of irregular chiasm-like protein 2; kin of IRRE-like 2; kin of IRRE-like protein 2; kin of IRRE-like protein 2; LOW QUALITY PROTEIN: kin of IRRE-like protein 2; kirre like nephrin family adhesion molecule 2; KIRREL2; MGC15718; NEPH3; nephrin-like 3; nephrin-like gene 1; nephrin-like protein 3; NLG1; UNQ5827/PRO19646; x kin of IRRE like 2
Common Name KIRREL2
Gene Symbol KIRREL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.