missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209433

Invitrogen™ Human IP6K2 (aa 73-140) Control Fragment Recombinant Protein

Product Code. 30209433
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209433 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209433 Supplier Invitrogen™ Supplier No. RP108575

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The members of the inositol hexakisphosphate kinase family, IP6K1 and IP6K2, have a high affinity and selectivity for inositol hexakisphosphate (InsP6) as a substrate. IP6K1 and IP6K2 (also designated PiUS) convert InsP6 to PP-InsP5. However, neither kinase demonstrates any catalytic activity with other inositol pyrophosphates. The presence of InsP6, which inhibits serine/threonine protein phosphatases, increases the influx of calcium across the plasma membrane and implies that it may mediate the regulation of insulin exocytosis. IP6K1 was purified as a 54 kDa protein in rat brain extracts. By homology, IP6K1 and IP6K2 were characterized in mouse as a 50 kDa and 49 kDa protein, respectively. IP6K1 displays ATP synthase activity by transferring a phosphate from PP-InsP5 to ADP, which suggests a role for the IP6 kinases as high energy phosphate donors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UHH9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51447
Name Human IP6K2 (aa 73-140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500005N04Rik; ATP:1 D-myo-inositol-hexakisphosphate phosphotransferase; AW050208; Ihpk2; Inositol hexakisphosphate kinase 2; inositol hexaphosphate kinase 2; inositol-hexakisphosphate kinase; insp6 kinase 2; IP6 Kinase; IP6K2; P(i)-uptake stimulator; pi uptake stimulator; Pius; TCCCIA00113
Common Name IP6K2
Gene Symbol Ip6k2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.