missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213259

Invitrogen™ Human IKAP (aa 1231-1332) Control Fragment Recombinant Protein

Product Code. 30213259
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213259

Brand: Invitrogen™ RP104882

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111296 (PA5-111296. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95163
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8518
Name Human IKAP (aa 1231-1332) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110040G09Rik; 6030413P05; C78473; DKFZp781H1425; DYS; elongator acetyltransferase complex subunit 1; elongator complex protein 1; Elp1; FD; FLJ12497; IKAP; IkappaB kinase complex-associated protein; IKBKAP; IKI3; IKK complex-associated protein; IKK-complex-associated protein IKAP; inhibitor of kappa light polypeptide enhancer in B cells, kinase complex-associated protein; inhibitor of kappa light polypeptide enhancer in B-cells, kinase complex-associated protein; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein; p150; RP11-3J11.4; TOT1
Common Name IKAP
Gene Symbol ELP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.