missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213315

Invitrogen™ Human IFT172 (aa 1490-1599) Control Fragment Recombinant Protein

Product Code. 30213315
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213315

Brand: Invitrogen™ RP91636

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60861 (PA5-60861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFT172 is required for the maintenance and formation of cilia. IT plays an indirect role in hedgehog (Hh) signaling, cilia being required for all activity of the hedgehog pathway.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UG01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26160
Name Human IFT172 (aa 1490-1599) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930553F24Rik; avc1; BBS20; ift172; intraflagellar transport 172; intraflagellar transport 172 homolog; intraflagellar transport 172 protein; intraflagellar transport protein 172 homolog; Kiaa1179; LIM-interacting protein; moe; NPHP17; osm-1; Protein wimple; RP71; selective LIM binding factor homolog; selective LIM binding factor, rat homolog; selective LIM-binding factor; selective LIM-binding factor Wimple; si:dkey-221h15.5; Slb; SRTD10; Wim; wimple homolog
Common Name IFT172
Gene Symbol IFT172
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.