missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208544

Invitrogen™ Human IFI16 (aa 490-545) Control Fragment Recombinant Protein

Product Code. 30208544
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208544 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208544 Supplier Invitrogen™ Supplier No. RP110072

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145057 (PA5-145057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFI16 (gamma-inteferon-inducible protein 16) binds double-stranded DNA. It binds preferentially to supercoiled DNA and cruciform DNA structures. It seems to be involved in transcriptional regulation and as a transcriptional repressor. IFI16 may have a role in the regulation of hematopoietic differentiation through activation of unknown target genes. It controls cellular proliferation by modulating the functions of cell cycle regulatory factors including p53/TP53 and the retinoblastoma protein. IFI16 is also involved in innate immune response by recognizing viral dsDNA in the cytosol and nucleus. After binding to viral DNA in the cytoplasm, IFI16 recruits TMEM173/STING and mediates the induction of IFN-beta. It is necessary to activate the IFR3 signaling cascade suring human herpes simplex virus 1 infection and promotes the assembly of heterochromatin on herpesviral DNA and inhibiton of viral immediate-early gene expression and replication. IFI16 is also involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16666
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3428
Name Human IFI16 (aa 490-545) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias gamma-interferon-inducible protein 16; IFI 16 C; IFI16; Ifi-16; IFNGIP1; interferon gamma inducible protein 16; interferon, gamma-inducible protein 16; interferon-gamma induced protein IFI 16; interferon-inducible myeloid differentiation transcriptional activator; PYHIN2
Common Name IFI16
Gene Symbol IFI16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.