missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ICAD (aa 83-155) Control Fragment Recombinant Protein

Product Code. 30205361
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205361

Brand: Invitrogen™ RP92065

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ICAD is the inhibitor of caspase-3-activated DNase which is a substrate that controls nuclear apoptosis. ICAD has two isoforms: a functional isoform of 45kDa, ICAD-L/DNA fragmentation factor (DFF) 45; and a 35kDa isoform, ICAD-S/DFF35. Although both ICAD-L and ICAD-S can bind and inhibit CAD, only ICAD-L was reported to be functional. ICAD is cleaved to be inactivated and allow caspase-activated DNase (CAD) to execute nuclear internucleosomal apoptotic DNA fragmentation. In non-apoptotic cells, CAD is complexed with its inhibitor, ICAD. The activation of the CAD/ICAD complex occurs through the caspase 3-mediated cleavage of ICAD at residues 117 and 224, which results in three ICAD fragments that are then released from CAD. In addition to its DNase inhibitory activity, ICAD acts as a CAD specific folding chaperone. There are recent reports that ICAD is a potential target for restoring a normal apoptotic signal transduction pathway in colon and brain cancer cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for the ICAD gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00273
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1676
Name Human ICAD (aa 83-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A330085O09Rik; DFF; DFF1; DFF35; Dff45; DFF-45; Dffa; DNA fragmentation factor 45 kDa subunit; DNA fragmentation factor subunit alpha; DNA fragmentation factor, 45 kDa, alpha polypeptide; DNA fragmentation factor, alpha subunit; H13; ICAD; ICAD-L; ICAD-S; Inhibitor of CAD; RP23-121D17.3
Common Name ICAD
Gene Symbol DFFA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.