missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DPB1 Control Fragment Recombinant Protein

Product Code. 30209235
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209235

Brand: Invitrogen™ RP90436

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82411 (PA5-82411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P04440
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3115
Name Human HLA-DPB1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias beta1 domain MHC class II HLA DPB; CD; CELIAC1; class II HLA beta chain; DC-1 alpha chain; DC-alpha; DPB1; DQ-A1; GSE; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DP beta 1 chain; HLA class II histocompatibility antigen, DP(W4) beta chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA DP14-beta chain; HLA-DCA; HLA-DP; HLA-DP histocompatibility type, beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1; HLA-DQA; HLA-DQA1; HLA-DRA; HLA-DRA1; leucocyte antigen DQA1; leukocyte antigen alpha chain; major histocompatibility complex class II antigen beta chain; major histocompatibility complex, class II, DP beta 1; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC cla; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen DP beta 1 chain; MHC class II antigen DPB1; MHC class II antigen DPbeta1; MHC class II antigen DRA; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DP-beta-1; MHC class II HLA-DQ-alpha-1; MHC class II HLA-DRB1; MHC class II surface glycoprotein; MHC HLA DPB1; MHC HLA-DQ alpha; MLRW
Common Name HLA-DPB1
Gene Symbol HLA-DPB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado