missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198670

Invitrogen™ Human HLA-DOA (aa 25-74) Control Fragment Recombinant Protein

Product Code. 30198670
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198670 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198670 Supplier Invitrogen™ Supplier No. RP109842

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reacts with HLA-DO, a heterodimer formed by DNalpha and DObeta subunits in B cells. DNalpha and DObeta are the products of the non-classical class II genes, HLA-DNA and HLA-DOB, respectively. DO forms tight complexes with DM in the endoplasmic reticulum and is thereby sorted to lysosomal vesicles during antigen processing and presentation. It is tightly associated with DM and it is selectively expressed on antigen-presenting cells, such as B cells, dendritic cells and thymic epithelial cells. DO can enhance the efficiency of peptide loading and has been found to stabilize DM at low pH, preserving its chaperon activity. DO-DM complexes are more efficient than DM in protecting empty DR molecules. Reports describe DO as a co-chaperone of DM. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06340
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3111
Name Human HLA-DOA (aa 25-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HLA class II histocompatibility antigen, DO alpha chain; HLA-D0-alpha; HLA-DNA; HLA-DOA; HLADZ; HLA-DZA; lymphocyte antigen; major histocompatibility complex, class II, DN alpha; major histocompatibility complex, class II, DO alpha; MHC class II antigen DOA; MHC DN-alpha; MHC DZ alpha
Common Name HLA-DOA
Gene Symbol HLA-DOA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.