missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203912

Invitrogen™ Human FTSJ3 (aa 518-581) Control Fragment Recombinant Protein

Product Code. 30203912
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203912

Brand: Invitrogen™ RP107179

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84559 (PA5-84559. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q8IY81
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 117246
Name Human FTSJ3 (aa 518-581) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2'-O-ribose RNA methyltransferase SPB1 homolog; 2'-O-ribose RNA methyltransferase SPB1 homolog {ECO:0000255; AA537063; AU045295; C79843; D11Ertd400e; ectoplacental cone, invasive trophoblast giant cells, extraembryonic ectoderm and chorion sequence 3; Epcs3; FLJ20062; FtsJ homolog 3; FtsJ homolog 3 (E. coli); FtsJ RNA 2'-O-methyltransferase 3; FtsJ RNA methyltransferase homolog 3; FTSJ3; HAMAP-Rule:MF_03163}; pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3; pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3; pre-rRNA processing protein FTSJ3; pre-rRNA processing protein FTSJ3; pre-rRNA processing protein FTSJ3 {ECO:0000255; protein ftsJ homolog 3; Putative rRNA methyltransferase 3; putative rRNA methyltransferase 3 {ECO:0000255; rRNA (uridine-2'-O-)-methyltransferase 3; SB92; SPB1; SPB1 RNA methyltransferase homolog
Common Name FTSJ3
Gene Symbol FTSJ3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt