missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207573

Invitrogen™ Human FNDC1 (aa 1535-1633) Control Fragment Recombinant Protein

Código de producto. 30207573
Click to view available options
Quantity:
100 μL
Tamaño de la unidad:
100µL
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30207573

Marca: Invitrogen™ RP104190

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56603 (PA5-56603. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number Q4ZHG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84624
Name Human FNDC1 (aa 1535-1633) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110027O12Rik; 1110051A18Rik; Activation-associated cDNA protein; activator of G-protein signaling 8; AGS8; bA243O10.1; dJ322A24.1; expressed in synovial lining protein; fibronectin type III domain containing 1; fibronectin type III domain containing 2; fibronectin type III domain-containing protein 1; FNDC1; FNDC2; KIAA1866; MEL4B3; mKIAA1866
Common Name FNDC1
Gene Symbol FNDC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado