missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FKBP5 (aa 150-237) Control Fragment Recombinant Protein

Artikelnummer. 30200042
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30200042

missing translation for 'mfr': Invitrogen™ RP94652

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKBP5 is a member of the immunophilin protein family. This family plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP5 is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. The gene that encodes FKBP5 has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q13451
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2289
Name Human FKBP5 (aa 150-237) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 51 kDa FK506-binding protein; 51 kDa FKBP; 54 kDa progesterone receptor-associated immunophilin; AIG6; androgen-regulated protein 6; D17Ertd592e; Dit1; EC 5.2.1.8; FF1 antigen; FK506 binding protein 5; FK506-binding protein 5; FKBP prolyl isomerase 5; Fkbp5; FKBP-5; FKBP51; FKBP-51; FKBP54; HSP90-binding immunophilin; p54; peptidylprolyl cis-trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP5; PPIase; PPIase FKBP5; Ptg-10; rotamase; T-cell FK506-binding protein
Common Name FKBP5
Gene Symbol FKBP5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt