missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203409

Invitrogen™ Human FHOD3 (aa 667-792) Control Fragment Recombinant Protein

Product Code. 30203409
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203409

Brand: Invitrogen™ RP88592

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55158 (PA5-55158. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FHOD3 is a novel member of the formin homology family playing an important role in regulation of the actin cytoskeleton. It contains a DAD (diaphanous auto regulatory) domain, an FH1 (formin homology 1) domain, an FH2 (formin homology 2) domain and a GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. FHOD3 is a cytoplasmic protein where the main part of the protein localizes to actin fibers and the remaining part displays filamentous staining. A 1422 amino acid containing formin-related actin-organizing protein, FHOD3 may cause stress fiber formation together with cell elongation and may associate with nestin/NES-based interfilament (IF). Expression of FHOD3 is seen mainly in heart, kidney, and brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q2V2M9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80206
Name Human FHOD3 (aa 667-792) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930009H06Rik; FH1/FH2 domain-containing protein 3; Fhod3; Fhos2; Formactin2; Formactin-2; Formin homolog overexpressed in spleen 2; formin homology 2 domain containing 3; formin-family protein FHOS2; hFHOS2; KIAA1695; mFHOS2; mKIAA1695
Common Name FHOD3
Gene Symbol FHOD3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEAGRTQQEAEAVASLATRISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPNDKVPETAPVQPKTESDYIWDQLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.