missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206798

Invitrogen™ Human FAT3 Control Fragment Recombinant Protein

Product Code. 30206798
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206798

Brand: Invitrogen™ RP110211

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145082 (PA5-145082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAT1, FAT2, FAT3 and FAT4 are human homologs of Drosophila Fat, which is involved in tumor suppression and planar cell polarity (PCP). The atypical cadherin Fat3 ensures that retinal amacrine cells (ACs) develop this unipolar morphology. Fat3 expression was restricted to the nervous system, for example in the brain, it is expressed in a variety of regions and axon fascicles. However, its strongest expression was observed in the olfactory bulb and retina.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TDW7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 120114
Name Human FAT3 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430076A06Rik; Cadherin family member 15; cadherin-related family member 10; CDHF15; CDHR10; D430038H04Rik; FAT atypical cadherin 3; FAT tumor suppressor homolog 3; FAT tumor suppressor homolog 3 (Drosophila); Fat3; Fta3 protein; Gm1132; Gm510; hFat3; KIAA1989; MFAT3F; protocadherin Fat 3; protocadherin Fat3
Common Name FAT3
Gene Symbol FAT3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.