missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208142

Invitrogen™ Human ERMAP (aa 176-245) Control Fragment Recombinant Protein

Product Code. 30208142
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208142

Brand: Invitrogen™ RP108914

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139823 (PA5-139823. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERMAP has a possible role as a cell-adhesion or receptor molecule of erythroid cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96PL5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114625
Name Human ERMAP (aa 176-245) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409279; AI666418; BTN5; ERMAP; erythroblast membrane associated protein (Scianna blood group); erythroblast membrane-associated protein; erythroblast membrane-associated protein (Scianna blood group); erythroid membrane-associated protein; hERMAP; MGC118810; MGC118811; PRO2801; Radin blood group; Radin blood group (Rd); radin blood group antigen; RD; RDMGC118812; SC; Scianna blood group; Scianna blood group (Sc); scianna blood group antigen; SCMGC118813
Common Name ERMAP
Gene Symbol ERMAP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.