missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DQX1 (aa 182-279) Control Fragment Recombinant Protein

Product Code. 30210043
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210043 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210043 Supplier Invitrogen™ Supplier No. RP96113

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58674 (PA5-58674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DQX1 (DEAQ box RNA-dependent ATPase 1), also known as FLJ23757, is a 71 amino acid protein that contains one helicase ATP-binding domain and one helicase C-terminal domain. Localized to the nucleus, DQX1 catalyzes the conversion of ATP to ADP and a phosphate. Expressed as three isoforms produced by alternative splicing events, DQX1 is encoded by a gene that maps to human chomosome 2. As the second largest human chromosome, chromosome 2 makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. A number of genetic diseases are linked to genes on chromosome 2, including Harlequin icthyosis, sitosterolemia and Alstrom syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TE96
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 165545
Name Human DQX1 (aa 182-279) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310066E11Rik; ATP-dependent RNA helicase DQX1; DEAQ box polypeptide 1; DEAQ box polypeptide 1 (RNA-dependent ATPase); DEAQ box RNA-dependent ATPase 1; DEAQ RNA-dependent ATPase; DEAQ RNA-dependent ATPase DQX1; DEAQ-box RNA dependent ATPase 1; Dqx1
Common Name DQX1
Gene Symbol DQX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.