missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208147

Invitrogen™ Human DGKA (aa 26-105) Control Fragment Recombinant Protein

Product Code. 30208147
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208147

Brand: Invitrogen™ RP106091

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65409 (PA5-65409. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P23743
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1606
Name Human DGKA (aa 26-105) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 80 kDa diacylglycerol kinase; 80 kDa; AW146112; DAG kinase alpha; Dagk; Dagk1; Dgka; DGK-alpha; diacylglycerol kinase; diacylglycerol kinase alpha; diacylglycerol kinase alpha Flt2-Pr2; diacylglycerol kinase, alpha; diacylglycerol kinase, alpha 80 kDa; Diglyceride kinase; diglyceride kinase alpha; MGC12821; MGC42356; truncated diacylglycerol kinase alpha Flt1-Pr1; truncated diacylglycerol kinase alpha Flt1-Pr2
Common Name DGKA
Gene Symbol Dgka
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.