missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human DFNB31 Partial ORF (NP_056219, 808 a.a. - 907 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human DFNB31 Partial ORF (NP_056219, 808 a.a. - 907 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16115176
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16115176 10 μg 10µg
16125176 25 μg 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 16115176 Supplier Abnova™ Supplier No. H00025861Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

In rat brain, Cip98 interacts with a calmodulin-dependent serine kinase, CASK (MIM 300172), and may be involved in the formation of scaffolding protein complexes that facilitate synaptic transmission in the central nervous system (CNS) (Yap et al., 2003 [PubMed 12641734]). Mutations in this gene, also known as WHRN, cause DFNB31 (MIM 607084).[supplied by OMIM]

Sequence: GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML

Specifications

Accession Number NP_056219
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 25861
Molecular Weight (g/mol) 36.74kDa
Name DFNB31 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CIP98/DKFZp434N014/KIAA1526/RP11-9M16.1/USH2D/WHRN/WI
Common Name DFNB31
Gene Symbol DFNB31
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.