missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209301

Invitrogen™ Human DDX1 (aa 224-312) Control Fragment Recombinant Protein

Product Code. 30209301
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209301

Brand: Invitrogen™ RP95989

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83226 (PA5-83226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DDX1 (ATP-dependent RNA helicase DDX1) acts as an ATP-dependent RNA helicase. It is able to unwind both RNA-RNA and RNA-DNA duplexes. DDX1 possesses 5' single-stranded RNA overhand nuclease activity and ATPase activity on various RNA, but not DNA polynucleotides. DDX1, together with RELA, acts as a coactivator to enhance NF-kappa-b-mediated transcriptional activation. It also acts as a positive transcriptional regulator of cyclin CCND2 expression. It binds to the cyclin CCND2 promoter region. DDX1 is a component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double stranded RNA and plays a role in activation of a cascade of antiviral responses including the induction of proinflammatory cytokines via the adapter molecule TICAM1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92499
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1653
Name Human DDX1 (aa 224-312) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409185; ATP-dependent RNA helicase DDX1; DBP-RB; Ddx1; DEAD (Asp-Glu-Ala-Asp) box helicase 1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 1; DEAD box polypeptide 1; DEAD box protein 1; DEAD box protein retinoblastoma; DEAD box-1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1; DEAD/H-box helicase 1; UKVH5d
Common Name DDX1
Gene Symbol DDX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.