missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209465

Invitrogen™ Human Cytohesin 3 (aa 2-72) Control Fragment Recombinant Protein

Product Code. 30209465
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209465 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209465 Supplier Invitrogen™ Supplier No. RP90693

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82492 (PA5-82492. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRP1 (general receptor for phosphoinositides-1) contains a Pleckstrin homology (PH) domain as well as a Sec7 domain. The PH domain has high binding affinity for phosphatidylinositol 3,4,5-trisphosphate Ptdlns(3,4,5)P3), while the Sec7 homology domain is responsible for catalyzing guanine nucleotide exchange of ADP-ribosylation factor (ARF) proteins. GRP1 co-localizes with ARF6 and catalyzes GTP/GDP exchange on ARF6. It is known to interact with Ptdlns(3,4,5)P3 localized to the plasma membrane in vitro and may also be a Ptdlns(3,4,5)P3 receptor. Additionally, GRP1 may regulate protein sorting and membrane trafficking through interaction with the guanosine triphosphate ARF, and may control cell adhesion through interaction with integrins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43739
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9265
Name Human Cytohesin 3 (aa 2-72) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI648983; ARF nucleotide-binding site opener 3; ARNO3; CLM3; CYTH3; cytohesin 3; cytohesin-3; General receptor of phosphoinositides 1; GRP1; mSec7-3; PH, SEC7 and coiled-coil domain-containing protein 3; pleckstrin homology, Sec7 and coiled/coil domains 3; pleckstrin homology, Sec7 and coiled-coil domains 3; Protein ARNO3; PSCD3; rSec7-3; Sec7; SEC7 homolog C; Sec7C
Common Name Cytohesin 3
Gene Symbol Cyth3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.