missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205737

Invitrogen™ Human CUX1 (aa 724-826) Control Fragment Recombinant Protein

Product Code. 30205737
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205737

Brand: Invitrogen™ RP100734

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110668 (PA5-110668. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P39880, Q13948
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1523
Name Human CUX1 (aa 724-826) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CASP; CCAAT displacement protein; CDP; CDP/Cut; CDP1; CDP2; Cdpl1; Clox; COY1; cut homolog; cut like homeobox 1; CUTL1; cut-like 1; cut-like homeobox 1; Cux; Cux/CDP; Cux/CDP homeoprotein; CUX1; Cux-1; golgi integral membrane protein 6; GOLIM6; Homeobox protein cut-like 1; homeobox protein cux-1; Kiaa4047; Nbla10317; p100; p110; p200; p75; Protein CASP; putative protein product of Nbla10317
Common Name CUX1
Gene Symbol CUX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.