missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212960

Invitrogen™ Human CUEDC1 (aa 288-386) Control Fragment Recombinant Protein

Product Code. 30212960
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30212960 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30212960 Supplier Invitrogen™ Supplier No. RP93488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55201 (PA5-55201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CUE (coupling of ubiquitin conjugation to endoplasmic reticulum degradation) domain is an evolutionarily conserved, ∽40 amino acid monoubiquitin-binding domain that mediates intramolecular monoubiquitylation. CUE domains are present in eukaryotic proteins that are involved in ubiquitination and protein trafficking pathways and may be required for ubiquitination of the proteins in which they are found. CUEDC1 (CUE domain-containing protein 1) is a 386 amino acid protein that contains one CUE domain, suggesting a possible role in protein trafficking and degradation pathways. Two isoforms of CUEDC1 exist due to alternative splicing events. Defects in the gene encoding CUEDC1 may be associated with early stage cervical cancer, implicating CUEDC1 as a potential tumor marker.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NWM3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 404093
Name Human CUEDC1 (aa 288-386) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI841487; C330016O16Rik; CUE domain containing 1; CUE domain-containing protein 1; Cuedc1; RGD1304861
Common Name CUEDC1
Gene Symbol CUEDC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.