missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CK2 alpha-2 (aa 318-350) Control Fragment Recombinant Protein

Product Code. 30213310
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213310

Brand: Invitrogen™ RP108122

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67467 (PA5-67467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Casein kinase II is a protein serine/threonine kinase that is thought to be present in all eukarotic cells, implying that it has fundamental cellular functions. The holoenzyme is a tetramer containing 2 alpha or alpha-prime subunits (or one of each) and 2 beta subunits. The function of beta subunits is unknown and the alpha subunit is the catalytic unit. CK2 functions as a tetrameric complex consisting of two regulatory beta-subunits and two catalytic units (alpha and alpha') in a homomeric or heteromeric conformation. Whilst the alpha- and alpha'-subunits are catalytically identical, proteins that regulate CK2, such as cdc2 and Hsp90, preferentially bind to the alpha and not the alpha'-subunit. CK2 can phosphorylate a number of key intracellular signaling proteins implicated in tumor suppression (p53 and PTEN) and tumorigenesis (myc, jun, NF-kappaB). CK2 is also thought to influence Wnt signaling via beta-catenin phosphorylation and the PI 3-K signaling pathway via the phosphorylation of Akt.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19784
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1459
Name Human CK2 alpha-2 (aa 318-350) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110035J23Rik; C77789; casein kinase 2 alpha; casein kinase 2 alpha'; casein kinase 2 alpha 2; casein kinase 2, alpha prime polypeptide; casein kinase II subunit alpha'; casein kinase II, alpha 2, polypeptide; CK II alpha'; CK2; CK2A2; CK2alpha'; CSNK2A1; CSNK2A2
Common Name CK2 alpha-2
Gene Symbol CSNK2A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.