missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200414

Invitrogen™ Human cGAS Control Fragment Recombinant Protein

Product Code. 30200414
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200414 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200414 Supplier Invitrogen™ Supplier No. RP110183

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cGAS (Cyclic GMP-AMP synthase) is a nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP and plays a key role in innate immunity. Catalysis involves both the formation of 2', 5' phosphodiester linkage at the GpA step and the formation of 3', 5' phosphodiester linkage at the ApG step. This produces c[G(2',5')pA(3'5')p] responses. cGAS also binds cytosolic DNA directly, leading to the activation and synthesis of cGAMP. Then, a second messenger binds to and activates TMEM173/STING thereby triggering type-I interferon production. cGAS is also involved in innate immune sensorship of infection, detection of DNA from bacteria, response to cellular stress, DNA damage, and regulation of cellular senescence.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N884
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 115004
Name Human cGAS Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C6orf150; h-cGAS; MB21D1
Common Name cGAS
Gene Symbol CGAS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNTRAYYFVKFKRNPKENHLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.