missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194535

Invitrogen™ Human CD28 (aa 180-220) Control Fragment Recombinant Protein

Product Code. 30194535
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194535

Brand: Invitrogen™ RP107728

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84832 (PA5-84832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD28 antigen is a 44 kDa disulfide linked homodimeric T cell specific surface glycoprotein. CD28 is a cell adhesion molecule of the immunoglobulin superfamily which is constitutively expressed on most peripheral blood T lymphocytes. Moreover, CD28 is the critical T cell costimulatory receptor that provides the cell the important second activation signal by binding CD80 and CD86 which are expressed by antigen presenting cells. In addition to its co-stimulation role, CD28 functions by preventing T cells from entering an anergic-hyporesponsive state or from undergoing premature apoptotic cell death. In murine peripheral lymphoid organs and in the blood, all CD4+ and CD8+ T cells express CD28. In the thymus, CD28 expression is highest on immature CD3-, CD8+ and CD4+8+ cells, and on CD4-8- cells that express alpha/beta and gamma/delta TCR. The level of CD28 on mature CD4+ and CD8+ alpha/beta TCR+ thymocytes is two- to fourfold lower than on the immature cells. Diseases associated with CD28 dysfunction include mycosis fungiodes and Sezary's Disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10747
Concentration 2.70 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 940
Name Human CD28 (aa 180-220) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias antigen CD28; CD28; CD28 antigen; CD28 antigen (Tp44); CD28 isoform; CD28 isoform 2; Cd28 molecule; CD28 precursor protein; CD28 protein; CD28 protein precursor; CD28RNA; cell surface protein; CHT28; contains partial extracellular domain; costimulatory molecule B7 receptor CD28; EGK_04709; MGC138290; sCD28; soluble CD28; T44; T-cell costimulatory molecule CD28; T-cell costimulatory molecule Tp44; T-cell-specific surface glycoprotein CD28; T-cell-specific surface glycoprotein CD28 homolog; TP44
Common Name CD28
Gene Symbol Cd28
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.