missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD206 (aa 29-143) Control Fragment Recombinant Protein

Product Code. 30193831
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193831

Brand: Invitrogen™ RP101913

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82136 (PA5-82136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD206 (MSR, Mannose receptor, MRC1) is a 175 kDa transmembrane protein belonging to the group of pattern recognition receptors. CD206 is predominantly expressed in tissue macrophages, dendritic cells, a subpopulation of endothelial cells and sperm cells. CD206 is thought to play a role in the innate and adaptive immune response. CD206 is also expressed on microglia and mato cells of the brain but not astrocytes or neurons. CD206 also mediate the recognition and uptake of a variety of macromolecules, including modified lipoproteins, advanced glycation end (AGEs) products and amyloid b-protein (Abeta). While the normal role of CD206 is associated with cell adhesion and host defense mechanisms, it also has been implicated in the development of atherosclerosis and Amyloid beta deposition in Alzheimer's disease (AD). CD206’s gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. CD206 has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. Other diseases associated with CD206 dysfunction include leprosy and Gaucher’s Disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22897
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4360
Name Human CD206 (aa 29-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW259686; bA541I19.1; CD206; CELE_Y39A3CR0.4; CLEC13D; CLEC13DL; C-type lectin domain family 13 member D; C-type lectin domain family 13 member D-like; ddp-1; hMR; Human mannose receptor; macrophage mannose receptor 1; Macrophage mannose receptor 1-like protein 1; mannose receptor, C type 1; mannose receptor, C type 1-like 1; Mitochondrial import inner membrane translocase subunit Tim8; MMR; MR; MRC1; MRC1L1; tim-8; Y39A3CR0.4
Common Name CD206 (MMR)
Gene Symbol Mrc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.