missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CCDC47 (aa 324-463) Control Fragment Recombinant Protein

Artikelnummer. 30208097
Click to view available options
Quantity:
100 μL
Packungsgröße:
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208097

Marke: Invitrogen™ RP94775

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56227 (PA5-56227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The coiled-coil domain is a common protein motif that is often involved in protein oligomerization and is found in proteins such as transcription factors and intermediate filaments. The CCDC47 gene maps to chromosome 17 at 17q23.3. Little is known about this single-pass membrane protein except that the coiled-coil domain is within the cytosolic domain near the carboxy terminus.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q96A33
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57003
Name Human CCDC47 (aa 324-463) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610204L23Rik; Adipocyte-specific protein 4; asp4; C88307; calumin; ccd47; CCDC47; coiled-coil domain containing 47; coiled-coil domain-containing protein 47; GK001; MSTP041; PSEC0077; RGD1308813
Common Name CCDC47
Gene Symbol Ccdc47
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt