missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209081

Invitrogen™ Human CCDC123 (aa 695-775) Control Fragment Recombinant Protein

Product Code. 30209081
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209081

Brand: Invitrogen™ RP102870

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58767 (PA5-58767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC123 (as known as CEP123), also named as CEP89, is a new player in the process of primary ciliogenesis and it also plays a role in mitochondrial metabolism where it may modulate complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriole and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formation and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96ST8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84902
Name Human CCDC123 (aa 695-775) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610507L03Rik; CCDC123; centrosomal protein 123; centrosomal protein 89; centrosomal protein 89 kDa; centrosomal protein of 89 kDa; Cep123; Cep89; coiled-coil domain containing 123; Coiled-coil domain-containing protein 123; coiled-coil domain-containing protein 123, mitochondrial
Common Name CCDC123
Gene Symbol CEP89
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVLKDKQEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCDVCSYD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.