missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204451

Invitrogen™ Human Caveolin 1 (aa 138-178) Control Fragment Recombinant Protein

Product Code. 30204451
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204451

Brand: Invitrogen™ RP103049

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Caveolin-1 or CAV1 is a scaffolding proteins within caveolar membranes. It interacts directly with G-protein alpha subunits and can functionally regulate their activity. Caveolin-1 is also involved in the co-stimulatory signal essential for T-cell receptor (TCR) mediated T-cell activation. It can bind with DPP4 and induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Mutations affecting the CAV1 gene can result in congenital generalized lipodystrophy 3, pulmonary hypertension primary 3, or partial lipodystrophy/congenital cataracts, and neurodegeneration syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q03135
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 857
Name Human Caveolin 1 (aa 138-178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BSCL3; CAV; CAV1; Cav-1; caveolae; caveolin 1; caveolin 1, caveolae protein; caveolin 1, caveolae protein, 22 kDa; caveolin 1 A; caveolin 1 b; caveolin caveolae protein 22 kDa; caveolin, caveolae protein 1; caveolin, caveolae protein, 22 kDa; caveolin-1; caveolin-1 A; caveolin-1 b; cell growth-inhibiting protein 32; CGL3; HGNC:1527; LCCNS; MSTP085; OTTHUMP00000196475; PPH3; Unknown (protein for IMAGE:7985573); variant a; variant b; vesicular integral-membrane protein VIP21; VIP21; wu:fc07c04
Common Name Caveolin 1
Gene Symbol CAV1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.