missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202062

Invitrogen™ Human Carbonic Anhydrase X (aa 275-328) Control Fragment Recombinant Protein

Produktkod. 30202062
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30202062

Brand: Invitrogen™ RP106797

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66106 (PA5-66106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9NS85
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56934
Name Human Carbonic Anhydrase x (aa 275-328) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700029L05Rik; BB085816; Ca10; Car10; carbonic anhydrase 10; carbonic anhydrase X; carbonic anhydrase-related protein 10; Carbonic anhydrase-related protein X; CARP X; CA-RP X; CARPX; CA-RPX; Cerebral protein 15; cerebral protein-15; HUCEP-15; UNQ533/PRO1076
Common Name Carbonic Anhydrase X
Gene Symbol CA10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.