missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209605

Invitrogen™ Human CAPNS2 (aa 153-203) Control Fragment Recombinant Protein

Product Code. 30209605
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209605

Brand: Invitrogen™ RP108284

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-84434 (PA5-84434, PA5-85009 (PA5-85009. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Calpain family of proteins are calcium-regulated thiol proteases which have broad endopeptidase activity throughout the body. Calpain small subunit 2, also known as CSS2 or CAPNS2, is a calcium-dependent protease that is expressed ubiquitously in the cytoplasm. Part of a heterodimer composed of a small subunit and a large subunit, CSS2 catalyzes proteolysis of various proteins involved in cytoskeletal remodeling and signal transduction. CSS2 also acts as a chaperone to the larger subunit, mediating its correct folding and conformation. When bound as a heterodimer, CSS2 is thought to keep the catalytic activity of the large subunit dormant. After binding calcium, CSS2 is released from the complex, thereby activating the large subunit and allowing CSS2 to translocate from the cytoplasm to the cell membrane. Defects in the gene encoding CSS2 result in incorrect calpain activity and retarded fetal development, suggesting that CSS2 expression is essential for proper growth.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96L46
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84290
Name Human CAPNS2 (aa 153-203) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310005G05Rik; 30 K-2; calcium-dependent protease small subunit 2; Calpain small subunit 2; calpain, small subunit 2; CAPNS2; CSS2
Common Name CAPNS2
Gene Symbol CAPNS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.