missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203587

Invitrogen™ Human CACNA2D1 (aa 528-668) Control Fragment Recombinant Protein

Product Code. 30203587
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203587 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203587 Supplier Invitrogen™ Supplier No. RP89930

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82340 (PA5-82340. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P54289
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 781
Name Human CACNA2D1 (aa 528-668) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ca(v)alpha2delta1; Cacna2; Cacna2d1; CACNL2A; Calcium channel subunit alpha 2 delta (dihydropyridine - sensitive L-type); calcium channel, L type, alpha 2 polypeptide; calcium channel, voltage-dependent, alpha 2/delta subunit 1; calcium channel, voltage-dependent, alpha2/delta subunit 1; calcium voltage-gated channel auxiliary subunit alpha2delta 1; CCHL2A; CCHLA2; DHP; DHSCCA; dihydropryridine-sensitive calcium channel alpha-2 subunit; dihydropyridine-sensitive calcium channel alpha 2; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; H_DJ0560O14.1; LINC01112; lncRNA-N3; MHS3; unknown protein; voltage-dependent calcium channel alpha-2 delta subunit precursor; Voltage-dependent calcium channel subunit alpha-2/delta-1; Voltage-dependent calcium channel subunit alpha-2-1; Voltage-dependent calcium channel subunit delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1; WUGSC:H_DJ0560O14.1
Common Name CACNA2D1
Gene Symbol Cacna2d1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.