missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203465

Invitrogen™ Human C9orf7 (aa 125-169) Control Fragment Recombinant Protein

Product Code. 30203465
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203465 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203465 Supplier Invitrogen™ Supplier No. RP91002

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110797 (PA5-110797. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transmembrane protein which mediates synaptic endocytosis and fitness-based cell culling. In response to different stimulus strengths, controls two major modes of synaptic vesicle (SV) retrieval in hippocampal neurons; Clathrin- mediated endocytosis (CME) in response to mild stimulation and activity-dependent bulk endocytosis (ADBE) in response to strong stimulation (By similarity). In cytotoxic T-lymphoocytes (CTLs) facilitates calcium-dependent endocytosis of cytotoxic granules at the immuno synapse (By similarity). Different isoforms work as fitness fingerprints in 'loser' and 'winner' cells and thereby mediate win/lose decisions as part of the cell competition process.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UGQ2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11094
Name Human C9orf7 (aa 125-169) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5930434B04Rik; C9orf7; CACFD1; calcium channel flower domain containing 1; calcium channel flower domain-containing protein 1; Calcium channel flower homolog; D9S2135; FLOWER; likely ortholog of H. sapiens chromosome 9 open reading frame 7 (C9orf7); mFwe; PSEC0107; PSEC0248; RGD1311501; UNQ3071/PRO9903
Common Name C9orf7
Gene Symbol CACFD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.