missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204020

Invitrogen™ Human BRK (aa 104-185) Control Fragment Recombinant Protein

Product Code. 30204020
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204020

Brand: Invitrogen™ RP96513

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83307 (PA5-83307. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Breast tumor kinase (Brk) is a non-receptor protein tyrosine kinase expressed in over 60% of breast carcinoma tissue samples and breast tumor cell lines. Brk is 80% identity to Sik (Src-related intestinal kinase) and exhibits the features of a novel non-receptor tyrosine kinase, including amino terminal SH3 and SH2 domains. Low levels of Brk transcripts have been identified in some human breast tumor cell lines but not in normal breast tissue.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13882
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5753
Name Human BRK (aa 104-185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ALT-PTK6; breast tumor kinase; BRK; deltam5; FLJ42088; protein tyrosine kinase 6; protein-tyrosine kinase 6; protein-tyrosine kinase BRK; Ptk6; PTK6 protein tyrosine kinase 6; Sik; SRC-related intestinal kinase; tks; Tksk; tyrosine kinase identified from skin; tyrosine-protein kinase BRK
Common Name BRK
Gene Symbol PTK6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.