missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BRF1 (aa 441-517) Control Fragment Recombinant Protein

Product Code. 30210371
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210371 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210371 Supplier Invitrogen™ Supplier No. RP109448

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA polymerase (pol) III synthesizes tRNA, 5s rRNA, 7SL RNA and U6 snRNA and is overexpressed in many transformed cell lines and tumors in vivo, since cells must duplicate its protein components before division. Therefore, in order to maintain rapid growth, cells must produce a high level of Pol III transcribed RNA, which requires the presence of the TFIIIB and TFIIIC2 transcription factor complexes. The TFIIIC2 complex is composed of five subunits, TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, that are overexpressed in adenovirus transformed cells as well as in malignant cells in vivo, such as ovarian carcinomas. TFIIIC2 recruits RNA pol III and TFIIIB to promoter elements and may be a key component in the deregulation of malignant cells. The TFIIIB complex includes the TATA-binding protein (TBP), TFIIB-related factor 1 (TFIIIB90, BRF1) and TFIIIB, the expression of which are also upregulated in transformed cells. In many carcinomas, the tumor suppressors retinoblastoma (RB) and p53 are inactivated, which affects their ability to bind and inactivate the function of TFIIIB.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92994
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2972
Name Human BRF1 (aa 441-517) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510002F24Rik; B - related factor 1; Berg36; B-related factor 1; BRF; BRF1; BRF-1; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae); BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit; BRF1, RNA polymerase III transcription initiation factor 90 subunit; butyrate response factor 1; CFDS; cMG1; early response factor Berg36; EGF-response factor 1; epididymis secretory sperm binding protein Li 76 p; ERF1; ERF-1; general transcription factor IIIB, 90 kD subunit; GTF3B; hBRF; HEL-S-76 p; hTFIIIB90; mRNA decay activator protein ZFP36L1; mTFIIIB90; RNF162B; TAF3B2; TAF3C; TAFIII90; TATA box binding protein (TBP)-associated factor 3 C; TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2; TATA box-binding protein-associated factor, RNA polymerase III, subunit 2; TBP - associated factor, RNA polymerase III, 90 kD; TF3B90; TFIIIB90; TIS11B; TPA-induced sequence 11 b; Transcription factor IIIB 90 kDa subunit; ZFP36 ring finger protein like 1; ZFP36 ring finger protein-like 1; ZFP36L1; ZFP36-like 1; zinc finger protein 36, C3H type-like 1; zinc finger protein 36, C3H1 type-like 1; zinc finger protein, C3H type, 36-like 1
Common Name BRF1
Gene Symbol BRF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.