missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Biliverdin Reductase (aa 4-95) Control Fragment Recombinant Protein

Product Code. 30210336
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210336

Brand: Invitrogen™ RP92683

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110854 (PA5-110854. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Biliverdin reductase (BLVR) is a ubiquitously expressed, small cytoplasmic oxidoreductase that catalyzes the reduction of biliverdin to bilirubin. The first step of this process is catalyzed by heme oxygenase, an enzyme that converts heme to iron, carbon monoxide, and biliverdin. BLVR is unique among all enzymes to date in being dual pH/dual cofactor-dependent, as it requires NADH (pH 6.7) or NADPH (pH 8.7) as an electron donor. There are two isoforms of BLVR, biliverdin-IX alpha-reductase (BLVRA), the major component of human adult liver, and biliverdin-IX beta-reductase (BLVRB), found predominantly in fetal liver. The product of BLVR, bilirubin, is an important biological antioxidant, however it is also a neurotoxin and the cause of kernicterus. In addition to being an antioxidant, it inhibits kinase activity and the activity of enzymes such as protein kinase C and NADPH oxidase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P53004
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 644
Name Human Biliverdin Reductase (aa 4-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610006A11Rik; 2500001N03Rik; Biliverdin reductase A; biliverdin reductase A-like protein; biliverdin-IX alpha-reductase; BLVR; Blvra; BVR; BVR A; BVRA; EC 1.3.1.24; testis tissue sperm-binding protein Li 61 n
Common Name Biliverdin Reductase
Gene Symbol Blvra
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.