missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211665

Invitrogen™ Human BAP31 (aa 141-240) Control Fragment Recombinant Protein

Product Code. 30211665
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211665

Brand: Invitrogen™ RP92343

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82124 (PA5-82124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BAP31 (B-Cell Receptor Associated Protein, 31-kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo- and hetero-oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL-2/BCL-XL-associated protein. In the C-terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51572
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10134
Name Human BAP31 (aa 141-240) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6C6 antigen; 6C6-AG; 6C6-AG tumor-associated antigen; accessory protein BAP31; B cell receptor associated protein 31; BAP31; Bcap31; B-cell receptor-associated protein 31; BCR-associated protein 31; BCR-associated protein Bap31; CDM; CDM protein; DDCH; DXS1357E; hypothetical protein LOC533949; OTTHUMP00000025978; p28; p28 Bap31; Protein CDM
Common Name BAP31
Gene Symbol BCAP31
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.