missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP Citrate Lyase (aa 227-327) Control Fragment Recombinant Protein

Product Code. 30205441
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30205441 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30205441 Supplier Invitrogen™ Supplier No. RP93261

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Two transcript variants encoding distinct isoforms have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P53396
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 47
Name Human ATP Citrate Lyase (aa 227-327) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17 bHSD10; 17 b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; A730098H14Rik; ABAD; AB-binding alcohol dehydrogenase; ACL; ACLY; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; ATP citrate lyase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPCL; AW538652; CAMR; citrate cleavage enzyme; CLATP; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; Hsd17b10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; Mitochondrial ribonuclease P protein 2; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MR x 17; MR x 31; MRXS10; SCHAD; SDR5C1; short chain dehydrogenase/reductase family 5 C member 1; short chain dehydrogenase/reductase family 5 C, member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; XH98G2
Common Name ATP Citrate Lyase
Gene Symbol Acly
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.