missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Apolipoprotein L3 Control Fragment Recombinant Protein

Product Code. 30211630
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211630

Brand: Invitrogen™ RP105919

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65168 (PA5-65168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein L gene family encodes six highly homologous proteins designated apoL1-6, which are associated with large high density type lipoproteins (HDL). The human apoL family maps to chromosome 22q12.1-13.1 within a 127,000 bp region. apoL2 and apoL3 may allow the binding of lipids to organelles or may be involved in the movement of lipids in the cytoplasm. apoL2 localizes to the cytoplasm and is widely expressed, with the highest levels observed in the lung, thymus, pancreas, placenta, adult brain and prostate. The apoL2 protein is also detected in the spleen, liver, kidney, colon, small intestine, uterus, spinal cord, adrenal gland, salivary gland, trachea, mammary gland, skeletal muscle, testis and fetal brain and liver. apoL3 also localizes to the cytoplasm and is widely expressed, with highest levels detected in the prostate, lung and placenta. It is also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland. Lower levels of apoL3 are observed in the brain, heart, fetal liver, pancreas and testis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95236
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80833
Name Human Apolipoprotein L3 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias APOL3; APOLIII; ApoL-III; apolipoprotein L, 3; Apolipoprotein L3; apolipoprotein L-III; CG12_1; CG121; CG12-1; OTTHUMP00000028913; TNF-inducible protein CG12-1
Common Name Apolipoprotein L3
Gene Symbol APOL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.