missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human APIP (aa 166-242) Control Fragment Recombinant Protein

Product Code. 30207151
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207151

Brand: Invitrogen™ RP92054

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82868 (PA5-82868. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian homologues of the key cell death gene CED-4 in C. elegans has been identified recently from human and mouse and designated Apaf 1 (for apoptosis protease-activating factor 1). Apaf 1 binds to cytochrome c (Apaf 2) and Caspase-9 (Apaf 3), which leads to Caspase-9 activation. Activated Caspase-9 in turn cleaves and activates Caspase-3 that is one of the key proteases, being responsible for the proteolytic cleavage of many key proteins in apoptosis. Recently, Cho et al (4) have identified a new Apaf 1 Interactiong Protein (APIP) also known as CG129 and MMRP19, as a negative regulator of ischemic injury. APIP competes with Caspase-9 binding site of Apaf 1. APIP is predicted to code for a 204 amino acid. An isoform of APIP, APIP2 encodes a 242 amino acid protein, which is an alternative splicing variant differing in its N-terminus from APIP. APIP transcript is ubiquitously expressed in most adult tissue with high expression in skeletal muscle, heart, and kidney.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96GX9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51074
Name Human APIP (aa 166-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias APAF1 interacting protein; APAF1-interacting protein; APIP; APIP2; CG129; CGI29; CGI-29; dJ179L10.2; hAPIP; Methylthioribulose-1-phosphate dehydratase; Mmrp19; monocyte macrophage 19; monocyte/macrophage protein 19; MTRu-1-P dehydratase; probable methylthioribulose-1-phosphate dehydratase; RGD1564562
Common Name APIP
Gene Symbol APIP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENGIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.