missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194113

Invitrogen™ Human Annexin A4 (aa 4-131) Control Fragment Recombinant Protein

Product Code. 30194113
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194113

Brand: Invitrogen™ RP88718

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82296 (PA5-82296. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09525
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 307
Name Human Annexin A4 (aa 4-131) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 35-beta calcimedin; 36 kDa zymogen granule membrane-associated protein; AI265406; AIV; annexin 4; annexin A4; Annexin IV; annexin IV (placental anticoagulant protein II); annexin-4; ANX IV; AN x 4; ANXA 4; Anxa4; ANXIV; AW106930; Carbohydrate-binding protein p33/p41; chromobindin-4; endonexin; endonexin I; epididymis secretory protein Li 274; HEL-S-274; Lipocortin IV; P32.5; p33/41 (annexin IV); PAP-II; PIG28; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; unnamed protein product; Xanx-4; ZAP 36/annexin IV; ZAP36; zymogen granule membrane associated protein
Common Name Annexin A4
Gene Symbol ANXA4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.