missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211802

Invitrogen™ Human ALDH3B2 (aa 352-385) Control Fragment Recombinant Protein

Product Code. 30211802
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211802

Brand: Invitrogen™ RP100382

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60934 (PA5-60934. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALDH3B2 (aldehyde dehydrogenase 3 family, member B2), also known as ALDH8, is a 385 amino acid protein that belongs to the ALDH family and is involved in the pathway of alcohol metabolism. Expressed in salivary gland tissue, ALDH3B2 functions to catalyze the NADP+-dependent conversion of an aldehyde into an acid. The gene encoding ALDH3B2 maps to human chromosome 11, which houses over 1, 400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48448
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 222
Name Human ALDH3B2 (aa 352-385) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acetaldehyde dehydrogenase 8; AI848594; aldehyde dehydrogenase 3 family member B2; aldehyde dehydrogenase 3 family, member B2; aldehyde dehydrogenase 8; Aldehyde dehydrogenase family 3 member B2; Aldh3b2; ALDH8; C130048D07Rik
Common Name ALDH3B2
Gene Symbol Aldh3b2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.